Cell Reactant:
Purine nucleoside phosphorylase
Syringe Reactant:
BDBM92923
Meas. Tech.:
Enzyme Inhibition
Entry Date.:
03/18/13
pH:
7.4±0
Temperature:
300.15±0 (K)
ΔH° :
-77.9±2 (kJ/mole)
Citation
 Edwards, AAMason, JMClinch, KTyler, PCEvans, GBSchramm, VL Altered enthalpy-entropy compensation in picomolar transition state analogues of human purine nucleoside phosphorylase. Biochemistry 48:5226-38 (2009) [PubMed]  Article
Cell React
Name:
Purine nucleoside phosphorylase
Synonyms:
Inosine phosphorylase | Inosine-guanosine phosphorylase | Purine nucleoside phosphorylase (PNPase)
Type:
Enzyme
Mol. Mass.:
32119.53
Organism:
Homo sapiens (Human)
Description:
n/a
Residue:
289
Sequence:
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
  
Syringe React
Name:
BDBM92923
Synonyms:
Immucillins, 6
Type:
Small molecule
Emp. Form.:
C12H16N4O3
Mol. Mass.:
264.2804
SMILES:
OC[C@H]1CN(Cc2c[nH]c3c2nc[nH]c3=O)CC1O |r|
Structure:
Search PDB for entries with ligand similarity: