Cell Reactant:
Haspin (465-798)
Syringe Reactant:
BDBM103302
Meas. Tech.:
Enzyme Inhibition
Entry Date.:
10/22/14
ΔG°:
-36.24±n/a (kJ/mole)
pH:
7.5±0
Temperature:
288.15±0 (K)
ΔH° :
-73.7±0.4 (kJ/mole)
ΔS° :
-0.13±0 (kJ/mole-K)
Citation
 Chaikuad, ATacconi, EMZimmer, JLiang, YGray, NSTarsounas, MKnapp, S A unique inhibitor binding site in ER K1/2 is associated with slow binding kinetics Nat Chem Biol 10:853-860 (2014) [PubMed]  Article
Cell React
Name:
Serine/threonine-protein kinase haspin [465-798]
Synonyms:
Haspin (aa 465-798)
Type:
Protein
Mol. Mass.:
37973.67
Organism:
Homo sapiens (Human)
Description:
Haspin kinase domain 465-798aa (curated by PDB 4QTC)
Residue:
334
Sequence:
GECSQKGPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK
  
Syringe React
Name:
BDBM103302
Synonyms:
SCH772984 | US8546404, 6
Type:
Small organic molecule
Emp. Form.:
C33H33N9O2
Mol. Mass.:
587.6742
SMILES:
O=C(CN1CC[C@@H](C1)C(=O)Nc1ccc2[nH]nc(-c3ccncc3)c2c1)N1CCN(CC1)c1ccc(cc1)-c1ncccn1 |r|
Structure:
Search PDB for entries with ligand similarity: