Cell Reactant:
ADC-7 beta-lactamase (ADC-7)
Syringe Reactant:
BDBM152695
Meas. Tech.:
Enzyme Inhibition
Entry Date.:
09/14/15
ΔG°:
-35.6±0 (kJ/mole)
pH:
7.4±0
Temperature:
298.15±0 (K)
ΔH° :
-39±0.4 (kJ/mole)
ΔS° :
-0.0028±0 (kJ/mole-K)
Citation
 Powers, RASwanson, HCTaracila, MAFlorek, NWRomagnoli, CCaselli, EPrati, FBonomo, RAWallar, BJ Biochemical and structural analysis of inhibitors targeting the ADC-7 cephalosporinase of Acinetobacter baumannii. Biochemistry 53:7670-9 (2014) [PubMed]  Article
Cell React
Name:
Beta-lactamase [24-383]
Synonyms:
ADC-7 beta-lactamase (ADC-7)
Type:
Protein
Mol. Mass.:
40642.04
Organism:
Acinetobacter baumannii (g-Proteobacteria)
Description:
A version of ADC-7 starting at amino acid 24.
Residue:
360
Sequence:
DNTPKDQEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSNTIFELGSVSKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEVQTDQQVLTFFKDWKPKNPIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLKHSYVNVPKTQMQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLSFIHANLNPQKYPTDIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISKEPSVKMYHKTGSTSGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYVVLNAIKK
  
Syringe React
Name:
BDBM152695
Synonyms:
S02030
Type:
Small organic molecule
Emp. Form.:
C11H13BN4O5S
Mol. Mass.:
324.121
SMILES:
OB(O)[C@H](Cn1cc(nn1)C(O)=O)NC(=O)Cc1cccs1 |r|
Structure:
Search PDB for entries with ligand similarity: