BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Gcn5-related N-acetyltransferases (GNAT) superfamily protein PA4794 (PA4794)
Syringe Reactant:BDBM82898
Meas. Tech.:Enzyme Inhibition
Entry Date:02/21/17
 
ΔG°:-27.3± (kJ/mole)
pH:7.5±0
Log10Kb:4.79± n/a
Temperature:298.15±0 (K)
ΔH° :-43.8±1.17 (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : -0.0552±0 (kJ/mole-K)
Comments:n/a
 
Citation Majorek, KAKuhn, MLChruszcz, MAnderson, WFMinor, W Structural, functional, and inhibition studies of a Gcn5-related N-acetyltransferase (GNAT) superfamily protein PA4794: a new C-terminal lysine protein acetyltransferase from pseudomonas aeruginosa. J Biol Chem288:30223-35 (2013) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info
 
Gcn5-related N-acetyltransferases (GNAT) superfamily protein PA4794 (PA4794)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Gcn5-related N-acetyltransferases (GNAT) superfamily protein PA4794 (PA4794)
Synonyms:n/a
Type:Protein
Mol. Mass.:17787.24
Organism:Pseudomonas aeruginosa
Description:Q9HV14
Residue:160
Sequence:
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQ
VLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNA
NAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLEP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82898
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM82898
Synonyms:(6R,7R)-3-(acetoxymethyl)-8-keto-7-[[2-(2-thienyl)acetyl]amino]-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid | (6R,7R)-3-(acetyloxymethyl)-8-oxidanylidene-7-(2-thiophen-2-ylethanoylamino)-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid | (6R,7R)-3-(acetyloxymethyl)-8-oxo-7-[(1-oxo-2-thiophen-2-ylethyl)amino]-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid | (6R,7R)-3-(acetyloxymethyl)-8-oxo-7-[(2-thiophen-2-ylacetyl)amino]-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid | Cephalothin | MLS001048966 | SMR000386987 | cid_6024
TypeSmall organic molecule
Emp. Form.C16H16N2O6S2
Mol. Mass.396.438
SMILESCC(=O)OCC1=C(N2[C@H](SC1)[C@H](NC(=O)Cc1cccs1)C2=O)C(O)=O |t:5|
Structure

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.