Cell Reactant:
Methylthioadenosine Phosphorylase (MTAP)
Syringe Reactant:
BDBM218803
Meas. Tech.:
Enzyme Inhibition
Entry Date.:
03/22/17
pH:
7.4±0
Temperature:
293.15±0 (K)
ΔH° :
13±0.4 (kJ/mole)
Citation
 Firestone, RSCameron, SAKarp, JMArcus, VLSchramm, VL Heat Capacity Changes for Transition-State Analogue Binding and Catalysis with Human 5'-Methylthioadenosine Phosphorylase. ACS Chem Biol 12:464-473 (2017) [PubMed]  Article
Cell React
Name:
S-methyl-5'-thioadenosine phosphorylase
Synonyms:
5'-Methylthioadenosine phosphorylase (MTAP) | MTA phosphorylase | MTAPase | Methylthioadenosine Phosphorylase (MTAP) | S-methyl-5 -thioadenosine phosphorylase
Type:
Enzyme
Mol. Mass.:
31239.23
Organism:
Homo sapiens (Human)
Description:
n/a
Residue:
283
Sequence:
MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH
  
Syringe React
Name:
BDBM218803
Synonyms:
ImmA
Type:
Small organic molecule
Emp. Form.:
C11H15N5O3
Mol. Mass.:
265.2685
SMILES:
Nc1ncnc2c(c[nH]c12)C1NC(CO)C(O)C1O
Structure:
Search PDB for entries with ligand similarity: