BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Phospholipase C-γ1 SH2 domain (PLCC_R716E)
Syringe Reactant:BDBM225239
Meas. Tech.:Enzyme Inhibition
Entry Date:05/11/17
 
ΔG°:-50.3± (kJ/mole)
pH:7.4±0
Log10Kb:8.82± 7.64
Temperature:298.15±0 (K)
ΔH° :n/a
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° :n/a
Comments:n/a
 
Citation McKercher, MAGuan, XTan, ZWuttke, DS Multimodal Recognition of Diverse Peptides by the C-Terminal SH2 Domain of Phospholipase C-1 Protein. Biochemistry56:2225-2237 (2017) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data
 
Phospholipase C-γ1 SH2 domain (PLCC_R716E)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Phospholipase C-γ1 SH2 domain (PLCC_R716E)
Synonyms:n/a
Type:Protein
Mol. Mass.:11531.50
Organism:Homo sapiens (Human)
Description:Human phospholipase C-γ1 C-terminal SH2 domain (663-759 aa) R716E mutant
Residue:97
Sequence:
HESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCEVQQEGQ
TVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM225239
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM225239
Synonyms:PDGFRB-pep
TypeSmall organic molecule
Emp. Form.C56H85N12O23P
Mol. Mass.1325.3145
SMILESCC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(OP(O)(O)=O)cc1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(O)=O)C(O)=O |r|
Structure

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.