Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene C4 synthase
LigandBDBM223290
Substrate/Competitorn/a
Meas. Tech.In Vitro hLTC4 Synthase Enzyme Assay
IC50 0.658±n/a nM
Citation Ronn, RLindh, CJRingberg, EAndersson, HBNilsson, PSchaal, WRMunck af Rosenschöld, MNikitidis, ANikitidis, GJohannesson, PTyrchan, C Compounds and uses US Patent US9657001 Publication Date 5/23/2017
More Info.:Get all data from this article,  Assay Method
 
Leukotriene C4 synthase
Name:Leukotriene C4 synthase
Synonyms:LTC4 synthase | LTC4S | Leukotriene-C(4) synthase
Type:PROTEIN
Mol. Mass.:16575.59
Organism:Homo sapiens (Human)
Description:ChEMBL_961179
Residue:150
Sequence:
MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYF
PLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVA
LAALGLLAHFLPAALRAALLGRLRTLLPWA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM223290
NameBDBM223290
Synonyms:(1S,2S)-2-[(5-{[2-Fluoro-5-(trifluoromethyl)phenyl](2-methylpropyl)amino}-3-methoxypyridin-2-yl)carbonyl]cyclopropanecarboxylic acid | US20160326143, 65 | US9657001, 65
TypeSmall Organic Molecule
Emp. Form.C22H22F4N2O4
Mol. Mass.454.4147
SMILESCOc1cc(cnc1C(=O)[C@H]1C[C@@H]1C(O)=O)N(CC(C)C)c1cc(ccc1F)C(F)(F)F
Structure
n/a