Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin
LigandBDBM14337
Substrate/CompetitorBDBM13790
Meas. Tech.Enzyme Assay and Determination of the Inhibition Constants
Ki 14±n/a nM
Citation Katz, BAElrod, KVerner, EMackman, RLLuong, CShrader, WDSendzik, MSpencer, JRSprengeler, PAKolesnikov, ATai, VWHui, HCBreitenbucher, JGAllen, DJanc, JW Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors. J Mol Biol329:93-120 (2003) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Trypsin
Name:Trypsin I
Synonyms:Beta-Trypsin | Cationic trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:25790.52
Organism:Bos taurus (bovine)
Description:P00760
Residue:246
Sequence:
MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14337
NameBDBM14337
Synonyms:2-{5-[amino(iminiumyl)methyl]-1H-indol-2-yl}-4-methoxy-6-phenylbenzen-1-olate | CRA-14783
TypeSmall organic molecule
Emp. Form.C22H19N3O2
Mol. Mass.357.4052
SMILESCOc1cc(-c2cc3cc(ccc3[nH]2)C(N)=[NH2+])c([O-])c(c1)-c1ccccc1
Structure
BDBM13790
NameBDBM13790
Synonyms:6-amino-2-[(1-{2-[(4-methylbenzene)sulfonamido]acetyl}pyrrolidin-2-yl)formamido]-N-(4-nitrophenyl)hexanamide; acetic acid | Chromogenic Substrate | Chromozym-PL | Tosyl-Gly-Pro-Lys-pNA | Tosyl-glycyl-polyl-lysine-4-nitranilide-acetate | Trypsin/Thrombin Chromogenic Substrate | Trypsin/Thrombin/Plasmin Chromogenic Substrate | Trypsin/Thrombin/Tryptase Chromogenic Substrate
TypeSmall Organic Molecule
Emp. Form.C26H34N6O7S
Mol. Mass.574.649
SMILESCc1ccc(cc1)S(=O)(=O)NCC(=O)N1CCCC1C(=O)NC(CCCCN)C(=O)Nc1ccc(cc1)[N+]([O-])=O
Structure