Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose Reductase (ALR2) Mutant (C298A)
LigandBDBM16419
Substrate/CompetitorBDBM16418
Meas. Tech.Enzyme Inhibition Assay
Ki 303000±n/a nM
Citation Brownlee, JMCarlson, EMilne, ACPape, EHarrison, DH Structural and thermodynamic studies of simple aldose reductase-inhibitor complexes. Bioorg Chem34:424-44 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Aldose Reductase (ALR2) Mutant (C298A)
Name:Aldose Reductase (ALR2) Mutant (C298A)
Synonyms:AR
Type:Enzyme
Mol. Mass.:35692.23
Organism:Homo sapiens (Human)
Description:n/a
Residue:315
Sequence:
ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQE
KLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKE
FFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPA
VNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKH
NKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVAAL
LSCTSHKDYPFHEEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16419
NameBDBM16419
Synonyms:2-phenylacetic acid | Benzeneacetic acid | CHEMBL1044 | Phenylacetate, XIX | Phenylacetic acid | phenylacetate
TypeSmall organic molecule
Emp. Form.C8H8O2
Mol. Mass.136.1479
SMILESOC(=O)Cc1ccccc1
Structure
BDBM16418
NameBDBM16418
Synonyms:benzyl alcohol | phenylmethanol
TypeSmall organic molecule
Emp. Form.C7H8O
Mol. Mass.108.1378
SMILESOCc1ccccc1
Structure