Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcFMS -Tie-2 Chimera
LigandBDBM17015
Substrate/CompetitorcFMS -Tie-2 Chimera
Meas. Tech.cFMs Autophosphorylation Fluorescence Polarization End Point Assay.
pH7.5±n/a
Temperature295.15±n/a K
IC50 1300±200 nM
Citation Schalk-Hihi, CMa, HCStruble, GTBayoumy, SWilliams, RDevine, EPetrounia, IPMezzasalma, TZeng, LSchubert, CGrasberger, BSpringer, BADeckman, IC Protein engineering of the colony-stimulating factor-1 receptor kinase domain for structural studies. J Biol Chem282:4085-93 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
cFMS -Tie-2 Chimera
Name:cFMS -Tie-2 Chimera
Synonyms:6His.FMS.538-922(TIE2) | Tyrosine Kinase CSF1-R Mutant (Tie2 KID Chimera)
Type:Other Protein Type
Mol. Mass.:37574.75
Organism:Homo sapiens (Human)
Description:Recombinant protein contains FMS cytoplasmic domain (FMS538-922.6His), in which FMS KID was replaced with Tie-2 KID.
Residue:333
Sequence:
GVDYKYKQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFG
KVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACT
HGGPVLVITEYCCYGDLLNFLRRKSRVLETDPAFAIANSTASTRDLLHFSSQVAQGMAFL
ASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFD
CVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIM
QACWALEPTHRPTFQQICSFLQEQAQEDRRERD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17015
NameBDBM17015
Synonyms:(3Z)-3-(1H-pyrrol-2-ylmethylidene)-2,3-dihydro-1H-indol-2-one | CHEMBL86755 | Indolinone based inhibitor, 1 | Oxindole I
TypeSmall organic molecule
Emp. Form.C13H10N2O
Mol. Mass.210.2313
SMILESO=C1Nc2ccccc2\C1=C\c1ccc[nH]1
Structure
cFMS -Tie-2 Chimera
Name:cFMS -Tie-2 Chimera
Synonyms:6His.FMS.538-922(TIE2) | Tyrosine Kinase CSF1-R Mutant (Tie2 KID Chimera)
Type:Other Protein Type
Mol. Mass.:37574.75
Organism:Homo sapiens (Human)
Description:Recombinant protein contains FMS cytoplasmic domain (FMS538-922.6His), in which FMS KID was replaced with Tie-2 KID.
Residue:333
Sequence:
GVDYKYKQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFG
KVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACT
HGGPVLVITEYCCYGDLLNFLRRKSRVLETDPAFAIANSTASTRDLLHFSSQVAQGMAFL
ASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFD
CVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIM
QACWALEPTHRPTFQQICSFLQEQAQEDRRERD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: