Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetB-RAF V600E
LigandBDBM88106
Substrate/Competitorn/a
Meas. Tech.In Vitro Raf Activity
IC50 1.81±n/a nM
Citation Aversa, RJBarsanti, PABurger, MTDillon, MPDipesa, AHu, CLou, YNishiguchi, GAPan, YPolyakov, VRRamurthy, SRico, ACSetti, LQSmith, ASubramanian, STaft, BRTanner, HRWan, LYusuff, N Biaryl amide compounds as kinase inhibitors US Patent US10245267 Publication Date 4/2/2019
More Info.:Get all data from this article,  Assay Method
 
B-RAF V600E
Name:B-RAF V600E
Synonyms:B-Raf (V600E) | B-Raf Protein Kinase Mutant (V600E) | B-Raf proto-oncogene serine/threonine-protein kinase | BRAF (V600E) | BRAF mutant V600E | P15056 | Protein mono-ADP-ribosyltransferase (PARP3) | RAF serine/threonine protein kinase (V600E) | Serine/threonine-protein kinase B-raf (V600E) | Serine/threonine-protein kinase B-raf (V600E) | V-RAF murine sarcoma viral oncogene homologue B1 mutant (BRAF V600E)
Type:n/a
Mol. Mass.:84474.98
Organism:Homo sapiens (Human)
Description:P15056 V600E
Residue:766
Sequence:
MAALSGGGGGGAEPGQALFNGDMEPEAGAGAGAAASSAADPAIPEEVWNIKQMIKLTQEH
IEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASMDTV
TSSSSSSLSVLPSSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDS
LKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRK
TFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPI
PQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQR
DRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSP
GPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDV
AVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHH
LHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATE
KSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNIN
NRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS
LPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM88106
NameBDBM88106
Synonyms:US10245267, Example 1143 | US10709712, Example 1143 | US9694016, 1143
TypeSmall organic molecule
Emp. Form.C25H27F2N5O3
Mol. Mass.483.5104
SMILESCCOc1cc(cc(n1)N1CCOCC1)-c1cc(NC(=O)c2ccnc(c2)C(C)(F)F)cnc1C
Structure
n/a