Target
Mitogen-activated protein kinase 1
Ligand
BDBM35643
Substrate
erktide
Meas. Tech.
Ki Determination
pH
7.5±n/a
Temperature
303.15±n/a K
Ki
<2±n/a nM
Citation
 Aronov, AMTang, QMartinez-Botella, GBemis, GWCao, JChen, GEwing, NPFord, PJGermann, UAGreen, JHale, MRJacobs, MJanetka, JWMaltais, FMarkland, WNamchuk, MNNanthakumar, SPoondru, SStraub, Jter Haar, EXie, X Structure-guided design of potent and selective pyrimidylpyrrole inhibitors of extracellular signal-regulated kinase (ERK) using conformational control. J Med Chem 52:6362-8 (2009) [PubMed]  Article
Target
Name:
Mitogen-activated protein kinase 1
Synonyms:
ERK2 | ERT1 | Extracellular signal-regulated kinase 2 | Extracellular signal-regulated kinase 2 (ERK-2) | Extracellular signal-regulated kinase 2 (ERK2) | MAP Kinase 2/ERK2 | MAPK 2 | MAPK1 | Mitogen activated kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK2) | Mitogen-activated protein kinase 2 | p42-MAPK
Type:
Ser/Thr Protein Kinase
Mol. Mass.:
41392.76
Organism:
Homo sapiens (Human)
Description:
P28482
Residue:
360
Sequence:
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
  
Inhibitor
Name:
BDBM35643
Synonyms:
pyrimidylpyrrole, 9b
Type:
Small organic molecule
Emp. Form.:
C25H25N5O2
Mol. Mass.:
427.4983
SMILES:
Cc1ccccc1Nc1ncc(C)c(n1)-c1c[nH]c(c1)C(=O)N[C@H](CO)c1ccccc1 |r|
Structure:
Search PDB for entries with ligand similarity:
Substrate
Name:
ERKtide
Synonyms:
n/a
Type:
Peptide
Mol. Mass.:
1314.49
Organism:
n/a
Description:
n/a
Residue:
13
Sequence:
ATGPLSPGPFGRR