Target
Glycogen synthase kinase-3 beta
Ligand
BDBM35643
Substrate
GSK-3 Substrate Peptide
Meas. Tech.
Ki Determination
Ki
330±n/a nM
Citation
 Aronov, AMTang, QMartinez-Botella, GBemis, GWCao, JChen, GEwing, NPFord, PJGermann, UAGreen, JHale, MRJacobs, MJanetka, JWMaltais, FMarkland, WNamchuk, MNNanthakumar, SPoondru, SStraub, Jter Haar, EXie, X Structure-guided design of potent and selective pyrimidylpyrrole inhibitors of extracellular signal-regulated kinase (ERK) using conformational control. J Med Chem 52:6362-8 (2009) [PubMed]  Article
Target
Name:
Glycogen synthase kinase-3 beta
Synonyms:
GSK-3 beta | GSK-3, beta | Glycogen synthase kinase 3 beta (GSK3B) | Glycogen synthase kinase 3-beta (GSK3B) | Glycogen synthase kinase-3 beta (GSK-3B) | Glycogen synthase kinase-3 beta (GSK3 Beta) | Glycogen synthase kinase-3 beta (GSK3B) | Glycogen synthase kinase-3B (GSK-3B) | Glycogen synthase kinase-3beta (GSK3B) | Serine/threonine-protein kinase GSK3B
Type:
Enzyme
Mol. Mass.:
46756.38
Organism:
Homo sapiens (Human)
Description:
P49841
Residue:
420
Sequence:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
  
Inhibitor
Name:
BDBM35643
Synonyms:
pyrimidylpyrrole, 9b
Type:
Small organic molecule
Emp. Form.:
C25H25N5O2
Mol. Mass.:
427.4983
SMILES:
Cc1ccccc1Nc1ncc(C)c(n1)-c1c[nH]c(c1)C(=O)N[C@H](CO)c1ccccc1 |r|
Structure:
Search PDB for entries with ligand similarity:
Substrate
Name:
GSK-3 Substrate Peptide
Synonyms:
n/a
Type:
Peptide
Mol. Mass.:
1641.04
Organism:
n/a
Description:
n/a
Residue:
14
Sequence:
HSSPHQSPHEDEEE