BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity phosphatase Cdc25B
LigandBDBM31704
Substrate/Competitorn/a
Meas. Tech.Cdc25B Catalytic Domain Protein Tyrosine Phosphatase HTS Dose Response Confirmation Assay
IC50 11637±n/a nM
Citation PubChem, PC Cdc25B Catalytic Domain Protein Tyrosine Phosphatase HTS Dose Response Confirmation Assay PubChem Bioassay(2006)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Dual specificity phosphatase Cdc25B
Name:Dual specificity phosphatase Cdc25B
Synonyms:Dual specificity phosphatase (CDC25B) | M-phase inducer phosphatase 2 (CDC25B)
Type:Protein
Mol. Mass.:64985.27
Organism:Homo sapiens (Human)
Description:n/a
Residue:580
Sequence:
MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMH
DLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMD
PHMAEQTFEQAIQAASRIIRNEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEA
GSGAASSSGEDKENDGFVFKMPWKPTHPSSTHALAEWASRREAFAQRPSSAPDLMCLSPD
RKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLKDDDAVPPGMESLISAPLVKT
LEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQ
QEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETM
VALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKR
VILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQ
DYRPMNHEAFKDELKTFRLKTRSWAGERSRRELCSRLQDQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31704
NameBDBM31704
Synonyms:MLS000050353 | N-(2,3-di-2-furyl-6-quinoxalinyl)-1-azepanecarboxamide | N-[2,3-bis(2-furanyl)-6-quinoxalinyl]-1-azepanecarboxamide | N-[2,3-bis(2-furyl)quinoxalin-6-yl]azepane-1-carboxamide | N-[2,3-bis(furan-2-yl)quinoxalin-6-yl]azepane-1-carboxamide | SMR000077614 | cid_2214811
TypeSmall organic molecule
Emp. Form.C23H22N4O3
Mol. Mass.402.4458
SMILESO=C(Nc1ccc2nc(-c3ccco3)c(nc2c1)-c1ccco1)N1CCCCCC1
Structure
n/a