BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetYopH
LigandBDBM42210
Substrate/Competitorn/a
Meas. Tech.YopH - IC50 determinations (10 point dose range)
IC50>50000±n/a nM
Citation PubChem, PC YopH - IC50 determinations (10 point dose range) PubChem Bioassay(2008)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
YopH
Name:Tyrosine-protein phosphatase yopH
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:50951.99
Organism:Yersinia enterocolitica
Description:ChEMBL_965525
Residue:468
Sequence:
MNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIASGARESEKVFAQTVL
SHVANIVLTQEDTAKLLQSTVKHNLNNYELRSVGNGNSVLVSLRSDQMTLQDAKVLLEAA
LRQESGARGHVSSHSHSVLHAPGTPVREGLRSHLDPRTPPLPPRERPHTSGHHGAGEARA
TAPSTVSPYGPEARAELSSRLTTLRNTLAPATNDPRYLQACGGEKLNRFRDIQCCRQTAV
RADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAENRTPVLAVLASSSEIANQRFGMPD
YFRQSGTYGSITVESKMTQQVGLGDGIMADMYTLTIREAGQKTISVPVVHVGNWPDQTAV
SSEVTKALASLVDQTAETKRNMYESKGSSAVADDSKLRPVIHCRAGVGRTAQLIGAMCMN
DSRNSQLSVEDMVSQMRVQRNGIMVQKDEQLDVLIKLAEGQGRPLLNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM42210
NameBDBM42210
Synonyms:(4-fluorobenzylidene)(phenyl)azane oxide | 1-(4-fluorophenyl)-N-phenyl-methanimine oxide | 1-(4-fluorophenyl)-N-phenylmethanimine oxide | MLS000533056 | SMR000140494 | cid_699581
TypeSmall organic molecule
Emp. Form.C13H10FNO
Mol. Mass.215.223
SMILES[O-]\[N+](=C/c1ccc(F)cc1)c1ccccc1
Structure
n/a