BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetX-linked inhibitor of apoptosis protein (XIAP)
LigandBDBM43782
Substrate/Competitorn/a
Meas. Tech.Chemical Antagonists of IAP-family anti-apoptotic proteins confirmation
IC50>200000±0 nM
Citation PubChem, PC Chemical Antagonists of IAP-family anti-apoptotic proteins confirmation PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
X-linked inhibitor of apoptosis protein (XIAP)
Name:X-linked inhibitor of apoptosis protein (XIAP)
Synonyms:E3 ubiquitin-protein ligase XIAP | Inhibitor of apoptosis protein 3 | Inhibitor of apoptosis protein 3 (XIAP) | X-linked inhibitor of apoptosis
Type:Protein
Mol. Mass.:56685.27
Organism:Homo sapiens (Human)
Description:P98170
Residue:497
Sequence:
MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENY
LGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE
SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTP
SLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKD
SMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFMS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM43782
NameBDBM43782
Synonyms:2-(1-ketoisoindolin-2-yl)propionic acid | 2-(3-oxidanylidene-1H-isoindol-2-yl)propanoic acid | 2-(3-oxo-1H-isoindol-2-yl)propanoic acid | MLS-0315756.0001 | cid_2764373
TypeSmall organic molecule
Emp. Form.C11H11NO3
Mol. Mass.205.2099
SMILESCC(N1Cc2ccccc2C1=O)C(O)=O
Structure
n/a