BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase D1
LigandBDBM32345
Substrate/Competitorn/a
Meas. Tech.Fluorescence polarization assay for PKD inhibitiors-interference assay-57K HTS campaign
IC50>50000±n/a nM
Citation PubChem, PC Fluorescence polarization assay for PKD inhibitiors-interference assay-57K HTS campaign PubChem Bioassay(2008)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Serine/threonine-protein kinase D1
Name:Protein kinase C, PKC; classical/novel
Synonyms:Protein kinase C mu | Protein kinase C mu type | Protein kinase C mu type (PRKD1) | Protein kinase D | Protein kinase D (PRKD1) | Serine/threonine-protein kinase D1 (PKD1) | nPKC-D1 | nPKC-mu
Type:Serine/threonine-protein kinase
Mol. Mass.:101705.07
Organism:Homo sapiens (Human)
Description:gi_115529463
Residue:912
Sequence:
MSAPPVLRPPSPLLPVAAAAAAAAAALVPGSGPGPAPFLAPVAAPVGGISFHLQIGLSRE
PVLLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGMYDKILLFRHDPTSENILQLVKAA
SDIQEGDLIEVVLSASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGC
GLNYHKRCAFKIPNNCSGVRRRRLSNVSLTGVSTIRTSSAELSTSAPDEPLLQKSPSESF
IGREKRSNSQSYIGRPIHLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQ
CKDCRFNCHKRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDM
EEAMVQDAEMAMAECQNDSGEMQDPDPDHEDANRTISPSTSNNIPLMRVVQSVKHTKRKS
STVMKEGWMVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILSLEPVKTS
ALIPNGANPHCFEITTANVVYYVGENVVNPSSPSPNNSVLTSGVGADVARMWEIAIQHAL
MPVIPKGSSVGTGTNLHRDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGG
KHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVME
KLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPF
PQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGT
FPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQ
DYQTWLDLRELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEET
EMKALGERVSIL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32345
NameBDBM32345
Synonyms:MLS000391610 | N'-(2-benzo[cd]indolyl)-4-bromobenzohydrazide | N'-benzo[cd]indol-2-yl-4-bromanyl-benzohydrazide | N'-benzo[cd]indol-2-yl-4-bromo-benzohydrazide | N'-benzo[cd]indol-2-yl-4-bromobenzohydrazide | SMR000260645 | cid_5044744
TypeSmall organic molecule
Emp. Form.C18H12BrN3O
Mol. Mass.366.211
SMILESBrc1ccc(cc1)C(=O)NNC1=Nc2cccc3cccc1c23 |t:12|
Structure
n/a