BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMCOLN3 protein
LigandBDBM44577
Substrate/Competitorn/a
Meas. Tech.Dose response cell-based high-throughput screening assay for agonists of the transient receptor potential channel ML3 (TRPML3)
EC50 3390±n/a nM
Citation PubChem, PC Dose response cell-based high-throughput screening assay for agonists of the transient receptor potential channel ML3 (TRPML3) PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
MCOLN3 protein
Name:MCOLN3 protein
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:64244.09
Organism:Homo sapiens (Human)
Description:Q8TDD5
Residue:553
Sequence:
MADPEVVVSSCSSHEEENRCNFNQQTSPSEELLLEDQMRRKLKFFFMNPCEKFWARGRKP
WKLAIQILKIAMVTIQLVLFGLSNQMVVAFKEENTIAFKHLFLKGYMDRMDDTYAVYTQS
DVYDQLIFAVNQYLQLYNVSVGNHAYENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPE
IETECFFVEPDEPFHIGTPAENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYD
FTLTITFDNKAHSGRIKISLDNDISIRECKDWHVSGSIQKNTHYMMIFDAFVILTCLVSL
ILCIRSVIRGLQLQQEFVNFFLLHYKKEVSVSDQMEFVNGWYIMIIISDILTIIGSILKM
EIQAKSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVIRFCCCAA
MIYLGYCFCGWIVLGPYHDKFRSLNMVSECLFSLINGDDMFATFAKMQQKSYLVWLFSRI
YLYSFISLFIYMILSLFIALITDTYETIKQYQQDGFPETELRTFISECKDLPNSGKYRLE
DDPPVSLFCCCKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM44577
NameBDBM44577
Synonyms:MLS000028538 | MLS000088404 | N-cyclohexyl-N-ethyl-2-methoxy-5-methyl-benzenesulfonamide | N-cyclohexyl-N-ethyl-2-methoxy-5-methylbenzenesulfonamide | SMR000058335 | SMR000071779 | TRIAMCINOLONE ACETONIDE | cid_2931464 | cid_6436
TypeSmall organic molecule
Emp. Form.C16H25NO3S
Mol. Mass.311.44
SMILESCCN(C1CCCCC1)S(=O)(=O)c1cc(C)ccc1OC
Structure
n/a