BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM43819
Substrate/Competitorn/a
Meas. Tech.Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist NMS competition at M2
EC50 48930±n/a nM
Citation PubChem, PC Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist NMS competition at M2 PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic acetylcholine receptor M2 and M5
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM43819
NameBDBM43819
Synonyms:4-[2-(2-thenoylamino)ethylamino]piperidine-1-carboxylic acid ethyl ester | 4-[2-[[oxo(thiophen-2-yl)methyl]amino]ethylamino]-1-piperidinecarboxylic acid ethyl ester | 4-{2-[(Thiophene-2-carbonyl)-amino]-ethylamino}-piperidine-1-carboxylic acid ethyl ester | VU0177548 | cid_647412 | ethyl 4-[2-(thiophen-2-ylcarbonylamino)ethylamino]piperidine-1-carboxylate | ethyl 4-[2-(thiophene-2-carbonylamino)ethylamino]piperidine-1-carboxylate
TypeSmall organic molecule
Emp. Form.C15H23N3O3S
Mol. Mass.325.426
SMILESCCOC(=O)N1CCC(CC1)NCCNC(=O)c1cccs1
Structure
n/a