BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta lactamase
LigandBDBM51965
Substrate/Competitorn/a
Meas. Tech.Epi-absorbance-based dose response biochemical high throughput screening assay for selective inhibitors of VIM-2 metallo-beta-lactamase
IC50 14379±n/a nM
Citation PubChem, PC Epi-absorbance-based dose response biochemical high throughput screening assay for selective inhibitors of VIM-2 metallo-beta-lactamase PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Beta lactamase
Name:Beta lactamase
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:31513.38
Organism:Pseudomonas aeruginosa
Description:gi_114881106
Residue:286
Sequence:
MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP
EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL
CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS
RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM51965
NameBDBM51965
Synonyms:3-(2-furanyl)-4-(2-methylpropyl)-1H-1,2,4-triazole-5-thione | 3-(2-furyl)-4-isobutyl-1H-1,2,4-triazole-5-thione | 3-(furan-2-yl)-4-(2-methylpropyl)-1H-1,2,4-triazole-5-thione | MLS000565615 | SMR000152755 | cid_843761
TypeSmall organic molecule
Emp. Form.C10H13N3OS
Mol. Mass.223.295
SMILESCC(C)Cn1c(n[nH]c1=S)-c1ccco1
Structure
n/a