BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHematopoietic protein-tyrosine phosphatase (HEPTP)
LigandBDBM32023
Substrate/Competitorn/a
Meas. Tech.HTS Discovery of Chemical Inhibitors of HePTP, a Leukemia Target
IC50 8330±n/a nM
Citation PubChem, PC HTS Discovery of Chemical Inhibitors of HePTP, a Leukemia Target PubChem Bioassay(2008)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Hematopoietic protein-tyrosine phosphatase (HEPTP)
Name:Hematopoietic protein-tyrosine phosphatase (HEPTP)
Synonyms:He-PTP | Hematopoietic protein-tyrosine phosphatase | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP)
Type:Protein
Mol. Mass.:40530.79
Organism:Homo sapiens (Human)
Description:P35236
Residue:360
Sequence:
MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32023
NameBDBM32023
Synonyms:(2E,4S,4aS,5aS,6S,12aS)-2-[amino(hydroxy)methylene]-4-(dimethylamino)-6,10,11,12a-tetrahydroxy-6-methyl-4,4a,5,5a-tetrahydrotetracene-1,3,12-trione | (2E,4S,4aS,5aS,6S,12aS)-2-[amino(hydroxy)methylidene]-4-(dimethylamino)-6,10,11,12a-tetrahydroxy-6-methyl-4,4a,5,5a-tetrahydrotetracene-1,3,12-trione | (2E,4S,4aS,5aS,6S,12aS)-2-[azanyl(oxidanyl)methylidene]-4-(dimethylamino)-6-methyl-6,10,11,12a-tetrakis(oxidanyl)-4,4a,5,5a-tetrahydrotetracene-1,3,12-trione | MLS000069728 | SMR000058220 | TETRACYCLINE | cid_5388997
TypeSmall organic molecule
Emp. Form.C22H24N2O8
Mol. Mass.444.4346
SMILESCN(C)[C@H]1[C@@H]2C[C@H]3C(C(=O)c4c(O)cccc4[C@@]3(C)O)C(=O)[C@]2(O)C(=O)C(C(N)=O)C1=O
Structure
n/a