BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetZinc aminopeptidase
LigandBDBM54147
Substrate/Competitorn/a
Meas. Tech.Inhibitors of Plasmodium falciparum M1- Family Alanyl Aminopeptidase (M1AAP)
IC50 7090±n/a nM
Citation PubChem, PC Inhibitors of Plasmodium falciparum M1- Family Alanyl Aminopeptidase (M1AAP) PubChem Bioassay(2008)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Zinc aminopeptidase
Name:Zinc aminopeptidase
Synonyms:m1-family aminopeptidase
Type:PROTEIN
Mol. Mass.:126072.31
Organism:Plasmodium falciparum (isolate FcB1 / Columbia)
Description:ChEMBL_735637
Residue:1085
Sequence:
MKLTKGCAYKYIIFTVLILANILYDNKKRCMIKKNLRISSCGIISRLLKSNSNYNSFNKN
YNFTSAISELQFSNFWNLDILQKDIFSNIHNNKNKPQSYIIHKRLMSEKGDNNNNNHQNN
NGNDNKKRLGSVVNNEENTCSDKRMKPFEEGHGITQVDKMNNNSDHLQQNGVMNLNSNNV
ENNNNNNSVVVKKNEPKIHYRKDYKPSGFIINNVTLNINIHDNETIVRSVLDMDISKHNV
GEDLVFDGVGLKINEISINNKKLVEGEEYTYDNEFLTIFSKFVPKSKFAFSSEVIIHPET
NYALTGLYKSKNIIVSQCEATGFRRITFFIDRPDMMAKYDVTVTADKEKYPVLLSNGDKV
NEFEIPGGRHGARFNDPHLKPCYLFAVVAGDLKHLSATYITKYTKKKVELYVFSEEKYVS
KLQWALECLKKSMAFDEDYFGLEYDLSRLNLVAVSDFNVGAMENKGLNIFNANSLLASKK
NSIDFSYARILTVVGHEYFHNYTGNRVTLRDWFQLTLKEGLTVHRENLFSEEMTKTVTTR
LSHVDLLRSVQFLEDSSPLSHPIRPESYVSMENFYTTTVYDKGSEVMRMYLTILGEEYYK
KGFDIYIKKNDGNTATCEDFNYAMEQAYKMKKADNSANLNQYLLWFSQSGTPHVSFKYNY
DAEKKQYSIHVNQYTKPDENQKEKKPLFIPISVGLINPENGKEMISQTTLELTKESDTFV
FNNIAVKPIPSLFRGFSAPVYIEDNLTDEERILLLKYDSDAFVRYNSCTNIYMKQILMNY
NEFLKAKNEKLESFNLTPVNAQFIDAIKYLLEDPHADAGFKSYIVSLPQDRYIINFVSNL
DTDVLADTKEYIYKQIGDKLNDVYYKMFKSLEAKADDLTYFNDESHVDFDQMNMRTLRNT
LLSLLSKAQYPNILNEIIEHSKSPYPSNWLTSLSVSAYFDKYFELYDKTYKLSKDDELLL
QEWLKTVSRSDRKDIYEILKKLENEVLKDSKNPNDIRAVYLPFTNNLRRFHDISGKGYKL
IAEVITKTDKFNPMVATQLCEPFKLWNKLDTKRQELMLNEMNTMLQEPNISNNLKEYLLR
LTNKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM54147
NameBDBM54147
Synonyms:2-[(2-{[3-(1,3-benzothiazol-2-yl)-4-methyl-2-thienyl]amino}-2-oxoethyl)sulfanyl]acetic acid | 2-[2-[[3-(1,3-benzothiazol-2-yl)-4-methyl-thiophen-2-yl]amino]-2-oxidanylidene-ethyl]sulfanylethanoic acid | 2-[2-[[3-(1,3-benzothiazol-2-yl)-4-methylthiophen-2-yl]amino]-2-oxoethyl]sulfanylacetic acid | 2-[[2-[[3-(1,3-benzothiazol-2-yl)-4-methyl-2-thienyl]amino]-2-keto-ethyl]thio]acetic acid | 2-[[2-[[3-(1,3-benzothiazol-2-yl)-4-methyl-2-thiophenyl]amino]-2-oxoethyl]thio]acetic acid | MLS000850157 | SMR000456175 | cid_2811247
TypeSmall organic molecule
Emp. Form.C16H14N2O3S3
Mol. Mass.378.489
SMILESCc1csc(NC(=O)CSCC(O)=O)c1-c1nc2ccccc2s1
Structure
n/a