BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA repair protein RAD51 homolog 1
LigandBDBM51319
Substrate/Competitorn/a
Meas. Tech.Homologous Recombination - Rad 51_Dose response
IC50 1399±n/a nM
Citation PubChem, PC Homologous Recombination - Rad 51_Dose response PubChem Bioassay(2008)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
DNA repair protein RAD51 homolog 1
Name:DNA repair protein RAD51 homolog 1
Synonyms:RAD51
Type:Enzyme Catalytic Domain
Mol. Mass.:36960.74
Organism:Homo sapiens (Human)
Description:gi_49168602
Residue:339
Sequence:
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM51319
NameBDBM51319
Synonyms:2-(7-benzyl-2,6-diketo-3-methyl-8-piperidino-purin-1-yl)acetic acid ethyl ester | 2-[3-methyl-2,6-dioxo-7-(phenylmethyl)-8-(1-piperidinyl)-1-purinyl]acetic acid ethyl ester | EPIRUBICIN HYDROCHLORIDE | MLS000037525 | MLS001401404 | SMR000041357 | SMR000466308 | cid_65348 | cid_660526 | ethyl 2-(7-benzyl-3-methyl-2,6-dioxo-8-piperidin-1-ylpurin-1-yl)acetate | ethyl 2-[3-methyl-2,6-bis(oxidanylidene)-7-(phenylmethyl)-8-piperidin-1-yl-purin-1-yl]ethanoate
TypeSmall organic molecule
Emp. Form.C22H27N5O4
Mol. Mass.425.4809
SMILESCCOC(=O)Cn1c(=O)n(C)c2nc(N3CCCCC3)n(Cc3ccccc3)c2c1=O
Structure
n/a