BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetstreptokinase A precursor
LigandBDBM54144
Substrate/Competitorn/a
Meas. Tech.Absorbance Microorganism-Based Dose Response HTS to Identify Inhibitors of Streptokinase Expression
EC50 150000±n/a nM
Citation PubChem, PC Absorbance Microorganism-Based Dose Response HTS to Identify Inhibitors of Streptokinase Expression PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
streptokinase A precursor
Name:streptokinase A precursor
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:49924.80
Organism:Streptococcus pyogenes M1 GAS
Description:gi_15675770
Residue:440
Sequence:
MKNYLSIGVIALLFALTFGTVKSVQAIAGYGWLPDRPPINNSQLVVSMAGIVEGTDKKVF
INFFEIDLTSQPAHGGKTEQGLSPKSKPFATDNGAMPHKLEKADLLKAIQKQLIANVHSN
DGYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLKGHVRVRPYKEKPVQNQ
AKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKTHPGY
TIYERDSSIVTHDNDIFRTILPMDQEFTYHVKNREQAYEINPKTGIKEKTNNTDLVSEKY
YVLKQGEKPYDPFDRSHLKLFTIKYVDVNTNELLKSEQLLTASERNLDFRDLYDPRDKAK
LLYNNLDAFDIMDYTLTGKVEDNHDKNNRVVTVYMGKRPKGAKGSYHLAYDKDLYTEEER
KAYSYLRDTGTPIPDNPKDK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM54144
NameBDBM54144
Synonyms:2-(2-{[3-(1,3-benzothiazol-2-yl)-4-methyl-2-thienyl]amino}-2-oxoethoxy)acetic acid | 2-[2-[[3-(1,3-benzothiazol-2-yl)-4-methyl-2-thienyl]amino]-2-keto-ethoxy]acetic acid | 2-[2-[[3-(1,3-benzothiazol-2-yl)-4-methyl-2-thiophenyl]amino]-2-oxoethoxy]acetic acid | 2-[2-[[3-(1,3-benzothiazol-2-yl)-4-methyl-thiophen-2-yl]amino]-2-oxidanylidene-ethoxy]ethanoic acid | 2-[2-[[3-(1,3-benzothiazol-2-yl)-4-methylthiophen-2-yl]amino]-2-oxoethoxy]acetic acid | MLS000850220 | SMR000456238 | cid_2811899
TypeSmall organic molecule
Emp. Form.C16H14N2O4S2
Mol. Mass.362.423
SMILESCc1csc(NC(=O)COCC(O)=O)c1-c1nc2ccccc2s1
Structure
n/a