BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor
LigandBDBM60276
Substrate/Competitorn/a
Meas. Tech.uHTS identification of small molecule antagonists of the kappa opioid receptor via a luminescent beta-arrestin assay
IC50 8040±n/a nM
Citation PubChem, PC uHTS identification of small molecule antagonists of the kappa opioid receptor via a luminescent beta-arrestin assay PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Kappa-type opioid receptor
Name:Kappa-type opioid receptor
Synonyms:K-OR-1 | KOR-1 | Kappa-opioid receptor (KOR) | Kappa-type opioid receptor (KOPR) | Kappa-type opioid receptor (KOR) | Kappa-type opioid receptor (Kappa) | OPIATE Kappa | OPRK | OPRK1 | kappa opioid receptor (KOR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42648.76
Organism:Homo sapiens (Human)
Description:P41145
Residue:380
Sequence:
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
RNTVQDPAYLRDIDGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM60276
NameBDBM60276
Synonyms:4-methyl-N-[9-(phenylmethyl)-9-azabicyclo[3.3.1]nonan-3-yl]benzamide | MLS001204239 | N-(9-Benzyl-9-aza-bicyclo[3.3.1]non-3-yl)-4-methyl-benzamide | N-(9-benzyl-9-azabicyclo[3.3.1]nonan-3-yl)-4-methyl-benzamide | N-(9-benzyl-9-azabicyclo[3.3.1]nonan-3-yl)-4-methylbenzamide | SMR000504596 | cid_24746888
TypeSmall organic molecule
Emp. Form.C23H28N2O
Mol. Mass.348.4812
SMILES[H]C12CCCC([H])(CC(C1)NC(=O)c1ccc(C)cc1)N2Cc1ccccc1
Structure
n/a