BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M1
LigandBDBM50305824
Substrate/Competitorn/a
Meas. Tech.Discovery of Novel Allosteric Modulators of the Muscarinic Receptor M5: Calcium Flux Assay
EC50 10280±n/a nM
Citation PubChem, PC Discovery of Novel Allosteric Modulators of the Muscarinic Receptor M5: Calcium Flux Assay PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Muscarinic acetylcholine receptor M1
Name:Muscarinic acetylcholine receptor M1
Synonyms:Cholinergic, muscarinic M1 | Chrm-1 | Chrm1 | cholinergic receptor, muscarinic 1
Type:Enzyme Catalytic Domain
Mol. Mass.:51390.46
Organism:RAT
Description:P08482
Residue:460
Sequence:
MNTSVPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDSEAQAPTKQPPKSSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTVNPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50305824
NameBDBM50305824
Synonyms:1-(4-methoxybenzyl)-6-(trifluoromethoxy)indoline-2,3-dione | CHEMBL595404 | cid_45281807
TypeSmall organic molecule
Emp. Form.C17H12F3NO4
Mol. Mass.351.2767
SMILESCOc1ccc(CN2C(=O)C(=O)c3ccc(OC(F)(F)F)cc23)cc1
Structure
n/a