BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-8
LigandBDBM62349
Substrate/Competitorn/a
Meas. Tech.SAR analysis of Muramyl dipeptide (MDP) induced IL-8 secretion in MCF-7/NOD2 cells - Set 2
IC50 13230±11560 nM
Citation PubChem, PC SAR analysis of Muramyl dipeptide (MDP) induced IL-8 secretion in MCF-7/NOD2 cells - Set 2 PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Interleukin-8
Name:Interleukin-8
Synonyms:MDNCF-a | interleukin 8 precursor
Type:PROTEIN
Mol. Mass.:11104.05
Organism:Homo sapiens (Human)
Description:ChEMBL_577736
Residue:99
Sequence:
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM62349
NameBDBM62349
Synonyms:MLS-0281326.0001 | N-[1-(4-chlorobenzyl)benzimidazol-2-yl]propionamide | N-[1-[(4-chlorophenyl)methyl]-2-benzimidazolyl]propanamide | N-[1-[(4-chlorophenyl)methyl]benzimidazol-2-yl]propanamide | cid_780945
TypeSmall organic molecule
Emp. Form.C17H16ClN3O
Mol. Mass.313.781
SMILESCCC(=O)Nc1nc2ccccc2n1Cc1ccc(Cl)cc1
Structure
n/a