BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLuxS
LigandBDBM65980
Substrate/Competitorn/a
Meas. Tech.Luminescence Microorganism-Based Dose Retest to Identify Modulators of the AI-2 Quorum Sensing System
EC50 3637±n/a nM
Citation PubChem, PC Luminescence Microorganism-Based Dose Retest to Identify Modulators of the AI-2 Quorum Sensing System PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
LuxS
Name:LuxS
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:15564.06
Organism:Vibrio harveyi
Description:B0LUE4
Residue:140
Sequence:
MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY
AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI
PELNEYQCGTAAMHSLDEAK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM65980
NameBDBM65980
Synonyms:MLS001211346 | N-(5-Bromo-pyridin-2-yl)-4-ethyl-benzenesulfonamide | N-(5-bromanylpyridin-2-yl)-4-ethyl-benzenesulfonamide | N-(5-bromo-2-pyridinyl)-4-ethylbenzenesulfonamide | N-(5-bromo-2-pyridyl)-4-ethyl-benzenesulfonamide | N-(5-bromopyridin-2-yl)-4-ethylbenzenesulfonamide | SMR000516778 | cid_766689
TypeSmall organic molecule
Emp. Form.C13H13BrN2O2S
Mol. Mass.341.224
SMILESCCc1ccc(cc1)S(=O)(=O)Nc1ccc(Br)cn1
Structure
n/a