BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLuxS
LigandBDBM65981
Substrate/Competitorn/a
Meas. Tech.Absorbance Microorganism-Based Dose Retest to Identify Inhibitors of Vibrio harveyi
EC50 4546±n/a nM
Citation PubChem, PC Absorbance Microorganism-Based Dose Retest to Identify Inhibitors of Vibrio harveyi PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
LuxS
Name:LuxS
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:15564.06
Organism:Vibrio harveyi
Description:B0LUE4
Residue:140
Sequence:
MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY
AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI
PELNEYQCGTAAMHSLDEAK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM65981
NameBDBM65981
Synonyms:MLS001176288 | N-(4-fluorophenyl)sulfonyl-N-methyl-4-propyl-benzenesulfonamide | N-(4-fluorophenyl)sulfonyl-N-methyl-4-propylbenzenesulfonamide | SMR000591598 | cid_8933071
TypeSmall organic molecule
Emp. Form.C16H18FNO4S2
Mol. Mass.371.447
SMILESCCCc1ccc(cc1)S(=O)(=O)N(C)S(=O)(=O)c1ccc(F)cc1
Structure
n/a