BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApelin receptor
LigandBDBM67308
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of uHTS hits from a small molecule antagonists of the APJ receptor via a luminescent beta-arrestin assay
IC50 7900±n/a nM
Citation PubChem, PC Dose Response confirmation of uHTS hits from a small molecule antagonists of the APJ receptor via a luminescent beta-arrestin assay PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Apelin receptor
Name:Apelin receptor
Synonyms:AGTRL1 | APJ | APLNR | Angiotensin receptor-like 1 | G-protein coupled receptor APJ | G-protein coupled receptor HG11
Type:Enzyme Catalytic Domain
Mol. Mass.:42664.06
Organism:Homo sapiens (Human)
Description:P35414
Residue:380
Sequence:
MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREK
RRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCL
TGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQ
CYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGL
RKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYV
NSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGK
GGEQMHEKSIPYSQETLVVD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM67308
NameBDBM67308
Synonyms:4-[1-(4-methylphenyl)-2-nitro-ethyl]sulfanylaniline | 4-[1-(4-methylphenyl)-2-nitroethyl]sulfanylaniline | 4-[[1-(4-methylphenyl)-2-nitroethyl]thio]aniline | 4-{[1-(4-methylphenyl)-2-nitroethyl]thio}aniline | MLS000861888 | SMR000460672 | [4-[[2-nitro-1-(p-tolyl)ethyl]thio]phenyl]amine | cid_2733001
TypeSmall organic molecule
Emp. Form.C15H16N2O2S
Mol. Mass.288.365
SMILESCc1ccc(cc1)C(C[N+]([O-])=O)Sc1ccc(N)cc1
Structure
n/a