BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein coupled receptor 35
LigandBDBM41203
Substrate/Competitorn/a
Meas. Tech.SAR analysis of NF-kappaB dependent luciferase using PMA/Ionomycin as an inducer - 2
IC50 17830±4835 nM
Citation PubChem, PC SAR analysis of NF-kappaB dependent luciferase using PMA/Ionomycin as an inducer - 2 PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
G-protein coupled receptor 35
Name:G-protein coupled receptor 35
Synonyms:G protein-coupled receptor 35
Type:Enzyme Catalytic Domain
Mol. Mass.:34085.57
Organism:Homo sapiens (Human)
Description:gi_33695097
Residue:309
Sequence:
MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMT
NLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRH
PLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGF
YLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVR
LAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKS
QDSLCVTLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM41203
NameBDBM41203
Synonyms:2-(1,3-Dimethyl-2,6-dioxo-7-propyl-2,3,6,7-tetrahydro-1H-purin-8-ylsulfanyl)-N-(4,5,6,7-tetrahydro-benzothiazol-2-yl)-acetamide | 2-(1,3-dimethyl-2,6-dioxo-7-propylpurin-8-yl)sulfanyl-N-(4,5,6,7-tetrahydro-1,3-benzothiazol-2-yl)acetamide | 2-[(1,3-dimethyl-2,6-dioxo-7-propyl-8-purinyl)thio]-N-(4,5,6,7-tetrahydro-1,3-benzothiazol-2-yl)acetamide | 2-[(2,6-diketo-1,3-dimethyl-7-propyl-purin-8-yl)thio]-N-(4,5,6,7-tetrahydro-1,3-benzothiazol-2-yl)acetamide | 2-[1,3-dimethyl-2,6-bis(oxidanylidene)-7-propyl-purin-8-yl]sulfanyl-N-(4,5,6,7-tetrahydro-1,3-benzothiazol-2-yl)ethanamide | MLS000029447 | SMR000002300 | cid_653676
TypeSmall organic molecule
Emp. Form.C19H24N6O3S2
Mol. Mass.448.562
SMILESCCCn1c(SCC(=O)Nc2nc3CCCCc3s2)nc2n(C)c(=O)n(C)c(=O)c12
Structure
n/a