BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNADPH oxidase 1
LigandBDBM67556
Substrate/Competitorn/a
Meas. Tech.Late-stage luminescence-based cell-based dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): Purchased analogs 2
IC50 6220±n/a nM
Citation PubChem, PC Late-stage luminescence-based cell-based dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): Purchased analogs 2 PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
NADPH oxidase 1
Name:NADPH oxidase 1
Synonyms:MOX-1 | MOX1 | Mitogenic oxidase 1 | NADH/NADPH mitogenic oxidase subunit P65-MOX | NOH-1 | NOH1 | NOX-1 | NOX1
Type:PROTEIN
Mol. Mass.:64890.44
Organism:Homo sapiens (Human)
Description:ChEMBL_792877
Residue:564
Sequence:
MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCL
NFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHL
FNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVI
MTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHP
RKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKV
VMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGD
WTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYK
FQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSN
IVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSL
RKCCHRYSSLDPRKVQFYFNKENF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM67556
NameBDBM67556
Synonyms:N-[4-[(E)-(phenylhydrazinylidene)methyl]phenyl]acetamide | N-[4-[(E)-(phenylhydrazinylidene)methyl]phenyl]ethanamide | N-[4-[(E)-(phenylhydrazono)methyl]phenyl]acetamide | SR-03000000890-1 | cid_9554832
TypeSmall organic molecule
Emp. Form.C15H15N3O
Mol. Mass.253.2991
SMILESCC(=O)Nc1ccc(CN=Nc2ccccc2)cc1 |w:10.10|
Structure
n/a