BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNADPH oxidase 1
LigandBDBM65837
Substrate/Competitorn/a
Meas. Tech.Luminescence-based cell-based dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): Cherry picks 2
IC50 370±n/a nM
Citation PubChem, PC Luminescence-based cell-based dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): Cherry picks 2 PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
NADPH oxidase 1
Name:NADPH oxidase 1
Synonyms:MOX-1 | MOX1 | Mitogenic oxidase 1 | NADH/NADPH mitogenic oxidase subunit P65-MOX | NOH-1 | NOH1 | NOX-1 | NOX1
Type:PROTEIN
Mol. Mass.:64890.44
Organism:Homo sapiens (Human)
Description:ChEMBL_792877
Residue:564
Sequence:
MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCL
NFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHL
FNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVI
MTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHP
RKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKV
VMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGD
WTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYK
FQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSN
IVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSL
RKCCHRYSSLDPRKVQFYFNKENF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM65837
NameBDBM65837
Synonyms:4-(4,5-diphenyl-1,3-dihydroimidazol-2-ylidene)-2-methoxy-1-cyclohexa-2,5-dienone | 4-(4,5-diphenyl-1,3-dihydroimidazol-2-ylidene)-2-methoxy-cyclohexa-2,5-dien-1-one | 4-(4,5-diphenyl-1,3-dihydroimidazol-2-ylidene)-2-methoxycyclohexa-2,5-dien-1-one | 4-(4,5-diphenyl-4-imidazolin-2-ylidene)-2-methoxy-cyclohexa-2,5-dien-1-one | SR-01000442018-2 | cid_5337430
TypeSmall organic molecule
Emp. Form.C22H18N2O2
Mol. Mass.342.3905
SMILESCOc1cc(ccc1O)-c1nc(c([nH]1)-c1ccccc1)-c1ccccc1
Structure
n/a