BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNADPH oxidase 1
LigandBDBM65839
Substrate/Competitorn/a
Meas. Tech.Late stage results from the probe development effort to identify inhibitors of NOX1: HEK/293 IC50 Set 2
IC50 2370±n/a nM
Citation PubChem, PC Late stage results from the probe development effort to identify inhibitors of NOX1: HEK/293 IC50 Set 2 PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
NADPH oxidase 1
Name:NADPH oxidase 1
Synonyms:MOX-1 | MOX1 | Mitogenic oxidase 1 | NADH/NADPH mitogenic oxidase subunit P65-MOX | NOH-1 | NOH1 | NOX-1 | NOX1
Type:PROTEIN
Mol. Mass.:64890.44
Organism:Homo sapiens (Human)
Description:ChEMBL_792877
Residue:564
Sequence:
MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCL
NFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHL
FNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVI
MTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHP
RKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKV
VMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGD
WTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYK
FQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSN
IVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSL
RKCCHRYSSLDPRKVQFYFNKENF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM65839
NameBDBM65839
Synonyms:1-(4-benzoxyphenyl)-3-[4-(dimethylamino)phenyl]urea | 1-[4-(dimethylamino)phenyl]-3-(4-phenylmethoxyphenyl)urea | SR-01000634030-1 | cid_2815705
TypeSmall organic molecule
Emp. Form.C22H23N3O2
Mol. Mass.361.4369
SMILESCN(C)c1ccc(NC(=O)Nc2ccc(OCc3ccccc3)cc2)cc1
Structure
n/a