BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein coupled receptor 35
LigandBDBM75859
Substrate/Competitorn/a
Meas. Tech.SAR analysis of Antagonists of the GPR35 Receptor using an Image-Based Assay - Set 5
IC50 307±n/a nM
Citation PubChem, PC SAR analysis of Antagonists of the GPR35 Receptor using an Image-Based Assay - Set 5 PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
G-protein coupled receptor 35
Name:G-protein coupled receptor 35
Synonyms:G protein-coupled receptor 35
Type:Enzyme Catalytic Domain
Mol. Mass.:34085.57
Organism:Homo sapiens (Human)
Description:gi_33695097
Residue:309
Sequence:
MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMT
NLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRH
PLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGF
YLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVR
LAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKS
QDSLCVTLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM75859
NameBDBM75859
Synonyms:5-[(E)-(tert-butylthiocarbamoylhydrazono)methyl]-1-phenyl-pyrazole-4-carboxylic acid methyl ester | 5-[(E)-[[(tert-butylamino)-sulfanylidenemethyl]hydrazinylidene]methyl]-1-phenyl-4-pyrazolecarboxylic acid methyl ester | MLS-0437442.0001 | cid_9581005 | methyl 5-[(E)-(tert-butylcarbamothioylhydrazinylidene)methyl]-1-phenyl-pyrazole-4-carboxylate | methyl 5-[(E)-(tert-butylcarbamothioylhydrazinylidene)methyl]-1-phenylpyrazole-4-carboxylate
TypeSmall organic molecule
Emp. Form.C17H21N5O2S
Mol. Mass.359.446
SMILESCOC(=O)c1cnn(c1C=NNC(=S)NC(C)(C)C)-c1ccccc1 |w:10.11|
Structure
n/a