BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein coupled receptor 55
LigandBDBM75860
Substrate/Competitorn/a
Meas. Tech.SAR Analysis of Selective Antagonists of GPR55 using an Image-Based Assay - Set 3
IC50 15100±n/a nM
Citation PubChem, PC SAR Analysis of Selective Antagonists of GPR55 using an Image-Based Assay - Set 3 PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
G-protein coupled receptor 55
Name:G-protein coupled receptor 55
Synonyms:G protein-coupled receptor 55
Type:PROTEIN
Mol. Mass.:36649.72
Organism:Homo sapiens (Human)
Description:ChEMBL_1292265
Residue:319
Sequence:
MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATS
IYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRF
LAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAK
VFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFL
PVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIR
AHRPSRVQLVLQDTTISRG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM75860
NameBDBM75860
Synonyms:1-phenyl-5-[(E)-(phenylthiocarbamoylhydrazono)methyl]pyrazole-4-carboxylic acid methyl ester | 5-[(E)-[[anilino(sulfanylidene)methyl]hydrazinylidene]methyl]-1-phenyl-4-pyrazolecarboxylic acid methyl ester | MLS-0300380.0001 | cid_9581006 | methyl 1-phenyl-5-[(E)-(phenylcarbamothioylhydrazinylidene)methyl]pyrazole-4-carboxylate
TypeSmall organic molecule
Emp. Form.C19H17N5O2S
Mol. Mass.379.436
SMILESCOC(=O)c1cnn(c1C=NNC(=S)Nc1ccccc1)-c1ccccc1 |w:10.11|
Structure
n/a