BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-galactosidase
LigandBDBM67308
Substrate/Competitorn/a
Meas. Tech.HTS Dose response counterscreen for assays utilizing the enzyme, beta-galactosidase - Set 2
EC50 31300±n/a nM
Citation PubChem, PC HTS Dose response counterscreen for assays utilizing the enzyme, beta-galactosidase - Set 2 PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Beta-galactosidase
Name:Beta-galactosidase
Synonyms:Beta-gal | Lactase | lacZ
Type:PROTEIN
Mol. Mass.:116943.87
Organism:Escherichia coli
Description:ChEMBL_215882
Residue:1029
Sequence:
MTMITPSFPGNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL
NGEWRFAWFPAPEAVPESWLECDLPEADTVVVPSNWQMHGYDAPIYTNVTYPITVNPPFV
PTENPTGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRLPSEFDLS
AFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQISDFHVATRFNDD
FSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVASGTAPFGGEIIDERGGYADRVTLRLN
VENPKLWSAEIPNLYRAVVELHTADGTLIEAEACDVGFREVRIENGLLLLNGKPLLIRGV
NRHEHHPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEAN
IETHGMVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWSLGNESGHGANHDALYRW
IKSVDPSRPVQYEGGGADTTATDIICPMYARVDEDQPFPAVPKWSIKKWLSLPGETRPLI
LCEYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDENGNPWSAYGGDFGD
TPNDRQFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGQTIEVTSEYLFRHSDNELLHW
MVALDGKPLASGEVPLDVAPQGKQLIELPELPQPESAGQLWLTVRVVQPNATAWSEAGHI
SAWQQWRLAENLSVTLPAASHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKK
QLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAV
LITTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLNCQLAQVAER
VNWLGLGPQENYPDRLTAACFDRWDLPLSDMYTPYVFPSENGLRCGTRELNYGPHQWRGD
FQFNISRYSQQQLMETSHRHLLHAEEGTWLNIDGFHMGIGGDDSWSPSVSAEFQLSAGRY
HYQLVWCQK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM67308
NameBDBM67308
Synonyms:4-[1-(4-methylphenyl)-2-nitro-ethyl]sulfanylaniline | 4-[1-(4-methylphenyl)-2-nitroethyl]sulfanylaniline | 4-[[1-(4-methylphenyl)-2-nitroethyl]thio]aniline | 4-{[1-(4-methylphenyl)-2-nitroethyl]thio}aniline | MLS000861888 | SMR000460672 | [4-[[2-nitro-1-(p-tolyl)ethyl]thio]phenyl]amine | cid_2733001
TypeSmall organic molecule
Emp. Form.C15H16N2O2S
Mol. Mass.288.365
SMILESCc1ccc(cc1)C(C[N+]([O-])=O)Sc1ccc(N)cc1
Structure
n/a