BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHematopoietic protein-tyrosine phosphatase (HEPTP)
LigandBDBM76335
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of compounds that inhibit HePTP
IC50 4120±n/a nM
Citation PubChem, PC Dose Response confirmation of compounds that inhibit HePTP PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Hematopoietic protein-tyrosine phosphatase (HEPTP)
Name:Hematopoietic protein-tyrosine phosphatase (HEPTP)
Synonyms:He-PTP | Hematopoietic protein-tyrosine phosphatase | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP)
Type:Protein
Mol. Mass.:40530.79
Organism:Homo sapiens (Human)
Description:P35236
Residue:360
Sequence:
MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM76335
NameBDBM76335
Synonyms:MLS000672558 | N-[4-(difluoromethoxy)phenyl]-6-methyl-2-(4-pyridinyl)-4-quinolinecarboxamide | N-[4-(difluoromethoxy)phenyl]-6-methyl-2-(4-pyridyl)cinchoninamide | N-[4-(difluoromethoxy)phenyl]-6-methyl-2-pyridin-4-yl-4-quinolinecarboxamide | N-[4-(difluoromethoxy)phenyl]-6-methyl-2-pyridin-4-ylquinoline-4-carboxamide | N-[4-[bis(fluoranyl)methoxy]phenyl]-6-methyl-2-pyridin-4-yl-quinoline-4-carboxamide | SMR000295431 | cid_1261372
TypeSmall organic molecule
Emp. Form.C23H17F2N3O2
Mol. Mass.405.3968
SMILESCc1ccc2nc(cc(C(=O)Nc3ccc(OC(F)F)cc3)c2c1)-c1ccncc1
Structure
n/a