BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHematopoietic protein-tyrosine phosphatase (HEPTP)
LigandBDBM76337
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of compounds that inhibit HePTP
IC50 6640±n/a nM
Citation PubChem, PC Dose Response confirmation of compounds that inhibit HePTP PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Hematopoietic protein-tyrosine phosphatase (HEPTP)
Name:Hematopoietic protein-tyrosine phosphatase (HEPTP)
Synonyms:He-PTP | Hematopoietic protein-tyrosine phosphatase | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP)
Type:Protein
Mol. Mass.:40530.79
Organism:Homo sapiens (Human)
Description:P35236
Residue:360
Sequence:
MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM76337
NameBDBM76337
Synonyms:10-methyl-3-(2-pyridin-2-ylethynyl)acridin-9-one | 10-methyl-3-[2-(2-pyridinyl)ethynyl]-9-acridinone | 10-methyl-3-[2-(2-pyridyl)ethynyl]acridin-9-one | MLS001250121 | SMR000685987 | cid_24792649
TypeSmall organic molecule
Emp. Form.C21H14N2O
Mol. Mass.310.3487
SMILESCn1c2ccccc2c(=O)c2ccc(cc12)C#Cc1ccccn1
Structure
n/a