BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetubiquitin-conjugating enzyme E2 N
LigandBDBM79170
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of uHTS for the identification of UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay
IC50>20000±0 nM
Citation PubChem, PC Dose Response confirmation of uHTS for the identification of UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay PubChem Bioassay(2011)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
ubiquitin-conjugating enzyme E2 N
Name:Ubiquitin-conjugating enzyme E2 N
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:17137.61
Organism:Homo sapiens (Human)
Description:EBI_101440
Residue:152
Sequence:
MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPE
EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP
LANDVAEQWKTNEAQAIETARAWTRLYAMNNI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM79170
NameBDBM79170
Synonyms:(S)-[2,8-bis(trifluoromethyl)-4-quinolinyl]-[(2R)-2-piperidinyl]methanol;hydrochloride | (S)-[2,8-bis(trifluoromethyl)-4-quinolyl]-[(2R)-2-piperidyl]methanol;hydrochloride | (S)-[2,8-bis(trifluoromethyl)quinolin-4-yl]-[(2R)-piperidin-2-yl]methanol;hydrochloride | MLS001332559 | Mefloquine hydrochloride | SMR000875233 | cid_65329
TypeSmall organic molecule
Emp. Form.C17H16F6N2O
Mol. Mass.378.3122
SMILESO[C@H]([C@H]1CCCCN1)c1cc(nc2c(cccc12)C(F)(F)F)C(F)(F)F
Structure
n/a