BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetintegrin alpha-L
LigandBDBM79614
Substrate/Competitorn/a
Meas. Tech.Dose Response of Developing T Cell Immune Modulators with powder sourced compounds
EC50 20137±n/a nM
Citation PubChem, PC Dose Response of Developing T Cell Immune Modulators with powder sourced compounds PubChem Bioassay(2011)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
integrin alpha-L
Name:integrin alpha-L
Synonyms:CD11 antigen-like family member A | Leukocyte adhesion glycoprotein LFA-1 alpha chain | Leukocyte function-associated molecule 1 alpha chain | Lymphocyte antigen 15
Type:Enzyme Catalytic Domain
Mol. Mass.:128317.79
Organism:Mus musculus
Description:P24063
Residue:1163
Sequence:
MSFRIAGPRLLLLGLQLFAKAWSYNLDTRPTQSFLAQAGRHFGYQVLQIEDGVVVGAPGE
GDNTGGLYHCRTSSEFCQPVSLHGSNHTSKYLGMTLATDAAKGSLLACDPGLSRTCDQNT
YLSGLCYLFPQSLEGPMLQNRPAYQECMKGKVDLVFLFDGSQSLDRKDFEKILEFMKDVM
RKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVA
HVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIF
ASEPVEEFVKILDTFEKLKDLFTDLQRRIYAIEGTNRQDLTSFNMELSSSGISADLSKGH
AVVGAVGAKDWAGGFLDLREDLQGATFVGQEPLTSDVRGGYLGYTVAWMTSRSSRPLLAA
GAPRYQHVGQVLLFQAPEAGGRWNQTQKIEGTQIGSYFGGELCSVDLDQDGEAELLLIGA
PLFFGEQRGGRVFTYQRRQSLFEMVSELQGDPGYPLGRFGAAITALTDINGDRLTDVAVG
APLEEQGAVYIFNGKPGGLSPQPSQRIQGAQVFPGIRWFGRSIHGVKDLGGDRLADVVVG
AEGRVVVLSSRPVVDVVTELSFSPEEIPVHEVECSYSAREEQKHGVKLKACFRIKPLTPQ
FQGRLLANLSYTLQLDGHRMRSRGLFPDGSHELSGNTSITPDKSCLDFHFHFPICIQDLI
SPINVSLNFSLLEEEGTPRDQKGRAMQPILRPSIHTVTKEIPFEKNCGEDKKCEANLTLS
SPARSGPLRLMSSASLAVEWTLSNSGEDAYWVRLDLDFPRGLSFRKVEMLQPHSRMPVSC
EELTEGSSLLTKTLKCNVSSPIFKAGQEVSLQVMFNTLLNSSWEDFVELNGTVHCENENS
SLQEDNSAATHIPVLYPVNILTKEQENSTLYISFTPKGPKTQQVQHVYQVRIQPSAYDHN
MPTLEALVGVPWPHSEDPITYTWSVQTDPLVTCHSEDLKRPSSEAEQPCLPGVQFRCPIV
FRREILIQVTGTVELSKEIKASSTLSLCSSLSVSFNSSKHFHLYGSKASEAQVLVKVDLI
HEKEMLHVYVLSGIGGLVLLFLIFLALYKVGFFKRNLKEKMEADGGVPNGSPPEDTDPLA
VPGEETKDMGCLEPSGRVTRTKA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM79614
NameBDBM79614
Synonyms:4-chloranyl-N-(cyclohexylmethyl)-3-morpholin-4-ylsulfonyl-benzamide | 4-chloro-N-(cyclohexylmethyl)-3-(4-morpholinylsulfonyl)benzamide | 4-chloro-N-(cyclohexylmethyl)-3-morpholin-4-ylsulfonylbenzamide | 4-chloro-N-(cyclohexylmethyl)-3-morpholinosulfonyl-benzamide | VU0424154-1 | cid_2128353
TypeSmall organic molecule
Emp. Form.C18H25ClN2O4S
Mol. Mass.400.92
SMILESClc1ccc(cc1S(=O)(=O)N1CCOCC1)C(=O)NCC1CCCCC1
Structure
n/a