BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetprobable DNA dC->dU-editing enzyme APOBEC-3A
LigandBDBM80505
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of small molecule APOBEC3A DNA Deaminase Inhibitors via a fluorescence-based single-stranded DNA deaminase assay
Temperature298.15±n/a K
IC50 2960±n/a nM
Commentsextracted
Citation PubChem, PC Dose Response confirmation of small molecule APOBEC3A DNA Deaminase Inhibitors via a fluorescence-based single-stranded DNA deaminase assay PubChem Bioassay(2011)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
probable DNA dC->dU-editing enzyme APOBEC-3A
Name:probable DNA dC->dU-editing enzyme APOBEC-3A
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:23013.77
Organism:Homo sapiens (Human)
Description:gi_21955158
Residue:199
Sequence:
MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAK
NLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHV
RLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLD
EHSQALSGRLRAILQNQGN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM80505
NameBDBM80505
Synonyms:(8,8-dimethyl-8-azoniabicyclo[3.2.1]octan-3-yl) benzoate;bromide | 3-(benzoyloxy)-8,8-dimethyl-8-azoniabicyclo[3.2.1]octane | MLS000766744 | SMR000339640 | benzoic acid (8,8-dimethyl-8-azoniabicyclo[3.2.1]octan-3-yl) ester;bromide | cid_16195076
TypeSmall organic molecule
Emp. Form.C16H22NO2
Mol. Mass.260.3508
SMILES[H]C12CCC([H])(CC(C1)OC(=O)c1ccccc1)[N+]2(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a