Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenylate cyclase
LigandBDBM50010709
Substrate/Competitorn/a
Ki 2.8±n/a nM
CommentsPDSP_3930
Citation Andersen, PHGrønvald, FCHohlweg, RHansen, LBGuddal, EBraestrup, CNielsen, EB NNC-112, NNC-687 and NNC-756, new selective and highly potent dopamine D1 receptor antagonists. Eur J Pharmacol219:45-52 (1992) [PubMed]  Article
More Info.:Get all data from this article
 
Adenylate cyclase
Name:Adenylate cyclase type II
Synonyms:ATP pyrophosphate-lyase 2 | Adenylate cyclase type 2 | Adenylyl cyclase 2
Type:PROTEIN
Mol. Mass.:123344.82
Organism:Rattus norvegicus
Description:ChEMBL_305824
Residue:1090
Sequence:
MRRRRYLRDRAEAAAAAAAGGGEGLQRSRDWLYESYYCMSQQHPLIVFLLLIVMGACLAL
LAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRVFSLVIWICLVAMG
YLFMCFGGTVSAWDQVSFFLFIIFVVYTMLPFNMRDAIIASILTSSSHTIVLSVYLSATP
GAKEHLFWQILANVIIFICGNLAGAYHKHLMELALQQTYRDTCNCIKSRIKLEFEKRQQE
RLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFTR
LASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVKM
GLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGV
PGRVHISSVTLEHLNGAYKVEEGDGEIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPRH
TLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTLR
TKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKNIEKEYRATALPAFK
YYVTCACLIFLCIFIVQILVLPKTSILGFSFGAAFLSLIFILFVCFAGQLLQCSKKASTS
LMWLLKSSGIIANRPWPRISLTIVTTAIILTMAVFNMFFLSNSEETTLPTANTSNANVSV
PDNQASILHARNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNTILLHTH
AHVLDAYSQVLFQRPGIWKDLKTMGSVSLSIFFITLLVLGRQSEYYCRLDFLWKNKFKKE
REEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFYT
ESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAIPSQEHAQ
EPERQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIW
GNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNTEMS
RSLSQSNLAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010709
NameBDBM50010709
Synonyms:5-Benzofuran-7-yl-8-chloro-3-methyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-7-ol | CHEMBL71600 | NNC-112 | NNC-112,(-)
TypeSmall organic molecule
Emp. Form.C19H18ClNO2
Mol. Mass.327.805
SMILESCN1CCc2cc(Cl)c(O)cc2[C@H](C1)c1cccc2ccoc12
Structure
n/a