Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor
LigandBDBM50170965
Substrate/Competitorn/a
Ki 1350±n/a nM
CommentsPDSP_4103
Citation Codd, EEShank, RPSchupsky, JJRaffa, RB Serotonin and norepinephrine uptake inhibiting activity of centrally acting analgesics: structural determinants and role in antinociception. J Pharmacol Exp Ther274:1263-70 (1995) [PubMed]
More Info.:Get all data from this article
 
Kappa-type opioid receptor
Name:Opioid receptor
Synonyms:KOR-1 | Kappa Opioid Receptor | OPIATE Kappa
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42692.90
Organism:Rattus norvegicus (rat)
Description:P34975
Residue:380
Sequence:
MESPIQIFRGEPGPTCAPSACLLPNSSSWFPNWAESDSNGSVGSEDQQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSAVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLASSVGISAIVLGGTKVREDVDVIECSLQFPDDEYSWWDLFMKICVFVFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITKLVLVVVAVFIICWTPIHIFILVEALG
STSHSTAVLSSYYFCIALGYTNSSLNPVLYAFLDENFKRCFRDFCFPIKMRMERQSTNRV
RNTVQDPASMRDVGGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50170965
NameBDBM50170965
Synonyms:17-hydroxy-10-methoxy-4-methyl-12-oxa-4-azapentacyclo[9.6.1.01,13.05,17.07,18]octadeca-7(18),8,10-trien-14-one | CHEMBL656 | Oxycodone | abacavir succinate | abacavir sulfate
TypeSmall organic molecule
Emp. Form.C18H21NO4
Mol. Mass.315.3636
SMILESCOc1ccc2C[C@H]3N(C)CC[C@@]45[C@@H](Oc1c24)C(=O)CCC35O |TLB:20:21:16.5.6:8.11.10,THB:22:21:16.5.6:8.11.10|
Structure
n/a