Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target14-3-3 protein zeta/delta
LigandBDBM50246102
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1676465
IC50 830±n/a nM
Citation Krüger, DMGlas, ABier, DPospiech, NWallraven, KDietrich, LOttmann, CKoch, OHennig, SGrossmann, TN Structure-Based Design of Non-natural Macrocyclic Peptides That Inhibit Protein-Protein Interactions. J Med Chem60:8982-8988 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
14-3-3 protein zeta/delta
Name:14-3-3 protein zeta/delta
Synonyms:14-3-3 protein zeta/delta | KCIP-1 | Protein kinase C inhibitor protein 1 | YWHAZ
Type:PROTEIN
Mol. Mass.:27731.18
Organism:Homo sapiens
Description:ChEMBL_117504
Residue:245
Sequence:
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50246102
NameBDBM50246102
Synonyms:CHEMBL4096939
TypeSmall organic molecule
Emp. Form.C68H109N13O21
Mol. Mass.1444.6676
SMILESCC(C)C[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@]1(C)CCCCCCCCCCCC[C@](C)(NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(C)=O)C(=O)N[C@H](C(=O)N[C@@H](CC(O)=O)C(=O)N1)C12CC3CC(CC(C3)C1)C2)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C(O)=O)C(O)=O)C(N)=O |r,TLB:60:72:75:79.77.78,THB:77:76:73:79.78.80,77:78:75.76.81:73,80:78:75:81.72.73,80:72:75:79.77.78|
Structure
n/a