Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAICAR transformylase
LigandBDBM50014844
Substrate/Competitorn/a
Meas. Tech.ChEMBL_28414
IC50 68000±n/a nM
Citation Kelley, JLMcLean, EWCohn, NKEdelstein, MPDuch, DSSmith, GKHanlon, MHFerone, R Synthesis and biological activity of an acyclic analogue of 5,6,7,8-tetrahydrofolic acid, N-[4-[[3-(2,4-diamino-1,6-dihydro-6-oxo-5- pyrimidinyl)propyl]amino]-benzoyl]-L-glutamic acid. J Med Chem33:561-7 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
AICAR transformylase
Name:AICAR transformylase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:64218.64
Organism:Mus musculus
Description:ChEMBL_28425
Residue:592
Sequence:
MAPSQLALFSVSDKTGLVEFARSLASLGLSLVASGGTAKAIRDAGLAVRDVSELTGFPEM
LGGRVKTLHPAVHAGILARNIPEDAADMARLDFNLVRVVVCNLYPFVKTVASPDVTVEAA
VEQIDIGGVTLLRAAAKNHARVTVVCEPEDYAGVAAEMHGSDSKDTSLETRRHLALKAFT
HTAQYDEAISDYFRKQYSKGISQMPLRYGMNPHQTPAQLYTLKPKLPITVLNGAPGFINL
CDALNAWQLVTELRGAVDIPAAASFKHVSPAGAAVGVPLSEDEARVCMVYDLYPTLTPLA
VAYARARGADRMSSFGDFVALSDICDVPTAKIISREVSDGIVAPGYEEEALKILSKKKNG
NYCVLQMDQSYKPDENEVRTLFGLRLSQKRNNGVVDKSLFSNIVTKNKDLPESALRDLIV
ATVAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKA
GVKRAEISNAIDQYVTGTIGEGEDLVKWEALFEEVPELLTEAEKKEWVDKLSGVSVSSDA
FFPFRDNVDRAKRSGVAYIVAPSGSTADKVVIEACDELGIVLAHTDLRLFHH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50014844
NameBDBM50014844
Synonyms:2-(4-{[3-(2,4-Diamino-6-oxo-1,6-dihydro-pyrimidin-5-yl)-propyl]-methyl-amino}-benzoylamino)-pentanedioic acid | CHEMBL153550
TypeSmall organic molecule
Emp. Form.C20H26N6O6
Mol. Mass.446.457
SMILESCN(CCCc1c(N)nc(N)[nH]c1=O)c1ccc(cc1)C(=O)NC(CCC(O)=O)C(O)=O
Structure
n/a