Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCatechol-O-methyltransferase
LigandBDBM50017865
Substrate/Competitorn/a
Meas. Tech.ChEBML_47065
IC50 3±n/a nM
Citation Bäckström, RHonkanen, EPippuri, AKairisalo, PPystynen, JHeinola, KNissinen, ELinden, IBMännistö, PTKaakkola, S Synthesis of some novel potent and selective catechol O-methyltransferase inhibitors. J Med Chem32:841-6 (1989) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Catechol-O-methyltransferase
Name:Catechol O-methyltransferase
Synonyms:n/a
Type:Enzyme
Mol. Mass.:29594.09
Organism:Rattus norvegicus (Rat)
Description:n/a
Residue:264
Sequence:
MPLAAVSLGLLLLALLLLLRHLGWGLVTIFWFEYVLQPVHNLIMGDTKEQRILRYVQQNA
KPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMA
RLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDM
VFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSY
LEYMKVVDGLEKAIYQGPSSPDKS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50017865
NameBDBM50017865
Synonyms:2,5-Bis-(3,4-dihydroxy-5-nitro-benzylidene)-cyclopentanone | CHEMBL265218
TypeSmall organic molecule
Emp. Form.C19H14N2O9
Mol. Mass.414.3225
SMILESOc1cc(\C=C2/CC\C(=C/c3cc(O)c(O)c(c3)[N+]([O-])=O)C2=O)cc(c1O)[N+]([O-])=O
Structure
n/a