Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSolute carrier family 15 member 1
LigandBDBM50240386
Substrate/Competitorn/a
Meas. Tech.ChEMBL_838264
Ki 2200000±n/a nM
Citation Terada, TSawada, KIrie, MSaito, HHashimoto, YInui, K Structural requirements for determining the substrate affinity of peptide transporters PEPT1 and PEPT2. Pflugers Arch440:679-84 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Solute carrier family 15 member 1
Name:Solute carrier family 15 member 1
Synonyms:Intestinal H(+)/peptide cotransporter | Oligopeptide transporter, small intestine isoform | Pept1 | Peptide transporter 1 | Proton-coupled dipeptide cotransporter | Slc15a1
Type:PROTEIN
Mol. Mass.:78933.78
Organism:Rattus norvegicus
Description:ChEMBL_1488841
Residue:710
Sequence:
MGMSKSRGCFGYPLSIFFIVVNEFCERFSYYGMRALLVLYFRNFLGWDDDLSTAIYHTFV
ALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVISVSSINDLTDHDHDGSPNNLPL
HVALSMIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTII
TPILRVQQCGIHSQQACYPLAFGVPAALMAVALIVFVLGSGMYKKFQPQGNIMGKVAKCI
RFAIKNRFRHRSKAFPKRNHWLDWAKEKYDERLISQIKIMTKVMFLYIPLPMFWALFDQQ
GSRWTLQATTMTGKIGTIEIQPDQMQTVNAILIVIMVPIVDAVVYPLIAKCGFNFTSLKK
MTVGMFLASMAFVVAAIVQVEIDKTLPVFPSGNQVQIKVLNIGNNDMAVYFPGKNVTVAQ
MSQTDTFMTFDVDQLTSINVSSPGSPGVTTVAHEFEPGHRHTLLVWGPNLYRVVKDGLNQ
KPEKGENGIRFVSTLNEMITIKMSGKVYENVTSHSASNYQFFPSGQKDYTINTTEIAPNC
SSDFKSSNLDFGSAYTYVIRSRASDGCLEVKEFEDIPPNTVNMALQIPQYFLLTCGEVVF
SVTGLEFSYSQAPSNMKSVLQAGWLLTVAIGNIIVLIVAEAGHFDKQWAEYVLFASLLLV
VCIIFAIMARFYTYINPAEIEAQFDEDEKKKGVGKENPYSSLEPVSQTNM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50240386
NameBDBM50240386
Synonyms:5-amino-4-oxopentanoic acid | 5-aminolevulinic acid | AMINOLEVULINIC ACID | Aminolevulinic Acid Hydrochloride | CHEMBL601 | Levulan | delta-aminolevulinic acid
TypeSmall organic molecule
Emp. Form.C5H9NO3
Mol. Mass.131.1299
SMILESNCC(=O)CCC(O)=O
Structure
n/a