Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOligopeptide transporter, kidney isoform
LigandBDBM50240386
Substrate/Competitorn/a
Meas. Tech.ChEMBL_838263
Ki 230000±n/a nM
Citation Terada, TSawada, KIrie, MSaito, HHashimoto, YInui, K Structural requirements for determining the substrate affinity of peptide transporters PEPT1 and PEPT2. Pflugers Arch440:679-84 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Oligopeptide transporter, kidney isoform
Name:Oligopeptide transporter, kidney isoform
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:81331.63
Organism:Rattus norvegicus
Description:ChEMBL_838253
Residue:729
Sequence:
MNPFQKNESKETLFSPVSTEEMLPRPPSPPKKSPPKIFGSSYPVSIAFIVVNEFCERFSY
YGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLV
YVLGHVFKSLGAIPILGGKMLHTILSLVGLSLIALGTGGIKPCVAAFGGDQFEEEHAEAR
TRYFSVFYLAINAGSLISTFITPMLRGDVKCFGQDCYALAFGVPGLLMVLALVVFAMGSK
MYRKPPPEGNIVAQVIKCIWFALCNRFRNRSGDLPKRQHWLDWAAEKYPKHLIADVKALT
RVLFLYIPLPMFWALLDQQGSRWTLQANKMNGDLGFFVLQPDQMQVLNPFLVLIFIPLFD
LVIYRLISKCRINFSSLRKMAVGMILACLAFAVAALVETKINGMIHPQPASQEIFLQVLN
LADGDVKVTVLGSRNNSLLVESVSSFQNTTHYSKLHLEAKSQDLHFHLKYNSLSVHNDHS
VEEKNCYQLLIHQDGESISSMLVKDTGIKPANGMAAIRFINTLHKDLNISLDTDAPLSVG
KDYGVSAYRTVLRGKYPAVHCETEDKVFSLDLGQLDFGTTYLFVITNITSQGLQAWKAED
IPVNKLSIAWQLPQYVLVTAAEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTVAVGNIIV
LVVAQFSGLAQWAEFVLFSCLLLVVCLIFSVMAYYYVPLKSEDTREATDKQIPAVQGNMI
NLETKNTRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50240386
NameBDBM50240386
Synonyms:5-amino-4-oxopentanoic acid | 5-aminolevulinic acid | AMINOLEVULINIC ACID | Aminolevulinic Acid Hydrochloride | CHEMBL601 | Levulan | delta-aminolevulinic acid
TypeSmall organic molecule
Emp. Form.C5H9NO3
Mol. Mass.131.1299
SMILESNCC(=O)CCC(O)=O
Structure
n/a