Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldehyde oxidase
LigandBDBM23515
Substrate/Competitorn/a
Meas. Tech.ChEMBL_892184
IC50>1000000±n/a nM
Citation Ford, KAGulevich, AGSwenson, TLCasida, JE Neonicotinoid insecticides: oxidative stress in planta and metallo-oxidase inhibition. J Agric Food Chem59:4860-7 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldehyde oxidase
Name:Aldehyde oxidase
Synonyms:Retinal oxidase
Type:PROTEIN
Mol. Mass.:147140.36
Organism:Oryctolagus cuniculus
Description:ChEMBL_696368
Residue:1334
Sequence:
MEPAPELLFYVNGRKVVEKQVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN
RVTKKIRHYPVNACLTPICSLYGAAVTTVEGIGSTTTRLHPVQERIAKFHGTQCGFCTPG
MVMSMYALLRNHPEPTLDQLADALGGNLCRCTGYRPIIEAYKTFCKTSDCCQNKENGFCC
LDQGINGLPEVEEENQTRPNLFSEEEYLPLDPTQELIFPPELMTMAEKQPQRTRVFSGER
MMWISPVTLKALLEAKSTYPQAPVVMGNTSVGPGVKFKGIFHPVIISPDSIEELNVVSHT
HSGLTLGAGLSLAQVKDILADVVQKVPEENAQTYRALLKHLGTLAGSQIRNMASLGGHII
SRHLDSDLNPLLAVGNCTLNVLSKEGERQIPLDEQFLSRCPEADLKPQEILASVHIPYSR
KWEFVLAFRQAQRKQNALAIVNSGMRVFFGEGDGIIRELAISYGGVGPTIICAKNSCQKL
IGRSWNEEMLDTACRLILDEVSLPGSAPGGKVEFKRTLIISFLFKFYLEVSQILKRMAPG
LSPHLADKYESALQDLHARYSWSTLKDQDVDARQLSQDPIGHPVMHLSGVKHATGEAIYL
DDMPAVDQELFMAFVTSPRAHAKIVSTDLLEALSLPGVVDIVTAEHLQDGNTFYTEKLLA
ADEVLCVGQLVCAVIAESEVQAKQAAKQVKIVYEDLEPVILSIEEAIEQKSFFEPERKLE
YGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSVLVVPKGEDQEMDVYASTQFPKYIQDM
VAAVLKLPVNKVMCHVKRVGGAFGGKVFKASIMAAIAAFAANKHGRAVRCILERGEDMLI
TGGRHPYLGKYKAGFMNDGRIVALDVEHYSNGGCSLDESLLVIEMGLLKMENAYKFPNLR
CRGWACRTNLPSNTAFRGFGFPQAGLITECCITEVAAKCGLSPEKVRAINFYKEIDQTPY
KQEINAKNLTQCWNECLAKSSYFQRKVAVEKFNAENYWKQRGLAIIPFKYPRGLGSVAYG
QAAALVHVYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELKMPMSNVHLRGTSTETVPNTN
ASGGSVVADLNGLAVKDACQTLLKRLEPIINKNPQGTWKEWAQAAFDKSISLSATGYFRG
YDSNIDWDKGEGHPFEYFVYGAACSEVEIDCLTGDHKTIRTDIVMDVGYSINPALDIGQV
EGAFIQGMGLYTIEELHYSPQGILYSRGPNQYKIPAICDIPAELNVTFLPPSEKSNTLYS
SKGLGESGVFMGCSVFFAIREAVCAARQARGLSAPWKLSSPLTPEKIRMACEDKFTKMIP
RDKPGSYVPWNVPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23515
NameBDBM23515
Synonyms:CHEMBL573 | Niacin | Nicotinic Acid | [5, 6-3H]-niacin | pyridine-3-carboxylic acid | wampocap
TypeSmall organic molecule
Emp. Form.C6H5NO2
Mol. Mass.123.1094
SMILESOC(=O)c1cccnc1
Structure
n/a